Recombinant Mouse LIF Protein, CYT-P09056
Background Information
Leukemia Inhibitory Factor (LIF) has been demonstrated to exert a wide array of significant biological effects. It releases calcium from bone tissue and acts as a differentiation inhibitory factor that prevents the spontaneous differentiation of normal embryonic stem cells [1]. LIF is involved in neural and immune responses to injury. Its levels are elevated in various animal and human inflammatory conditions. In some instances, such as following intratracheal lipopolysaccharide-induced inflammation, administration of LIF can suppress inflammatory symptoms. LIF also increases corticosterone levels via the hypothalamic-pituitary-adrenal axis. Exogenously added LIF induces acute-phase protein expression and stimulates the production of pro-inflammatory cytokines and monocyte chemoattractants [2]. Within the hematopoietic system, LIF induces the differentiation of certain leukemia cells and promotes the proliferation of hematopoietic stem cells, megakaryocyte progenitors, and DA1 cells. LIF also possesses activities in bone remodeling, induction of the acute-phase response in hepatocytes, inhibition of adipogenesis, modulation of neuronal differentiation, and inhibition of renal epithelial cell differentiation [3].
Description
LIF Protein, Mouse is a pleiotropic cytokine involved in various neural, hematopoietic, and inflammatory processes, including the acute-phase reaction, tissue damage response, and infection. This recombinant protein is produced in *E. coli*.
Full Name
Recombinant Mouse Leukemia Inhibitory Factor (LIF) Protein (E. coli-derived)
Specifications
Source: *Escherichia coli* (*E. coli*).
Species: Mouse.
Amino Acid Sequence (S24-F203): SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYT
AQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNAT
IDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAFSPLPITPVNA
TCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPF
Accession #: P09056 (S24-F203)
Gene ID: 16878 [NCBI]
Predicted Molecular Weight: 20 kDa.
Observed Molecular Weight: Approximately 18 kDa, as determined by SDS-PAGE under reducing conditions.
Protein Length: Full length of the mature protein. Tag: Tag Free.
Protein Structure:N-term ¡ª LIF (S24-F203) ¡ª C-term
Purity: >95% as determined by reducing SDS-PAGE.
Form: Sterile lyophilized powder.
Formulation: Lyophilized from a 0.22 µm filtered solution.
Note: For SPR (Surface Plasmon Resonance) assays, buffer exchange is recommended, as primary amine components (e.g., Tris) can interfere with protein coupling to sensor chips.
Endotoxin Level: <1 EU/µg, determined by the LAL method.
Biological Activity:
1. Measured by its ability to inhibit the differentiation of M1 murine myeloid leukemia cells. The ED₅₀ is <0.01 ng/mL, corresponding to a specific activity of >1.0 ¡Á 10⁸ units/mg.
2. Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse myelogenous leukemia cells. The ED₅₀ for this effect is 2.407 ng/mL, corresponding to a specific activity of 4.15 ¡Á 10⁵ U/mg.
3. Measured in a cell proliferation assay using C2C12 mouse myoblast cells. The ED₅₀ for this effect is 0.1-0.8 ng/mL.
Storage & Stability
Lyophilized Powder: Store at -20¡ãC for up to 2 years from the date of receipt.
Reconstituted Solution: After reconstitution, it is stable at 4¡ãC for 1 week or at -20¡ãC for longer periods when a carrier protein is added (see Reconstitution).
Long-term Storage: For extended storage, it is recommended to aliquot the reconstituted solution and freeze at -20¡ãC or -80¡ãC.
Shipping
Shipped at room temperature. Transit times may vary for destinations outside the continental US.
Aliases
rMuLIF; Differentiation-stimulating Factor; D factor; MLPLI; Cholinergic Differentiation Factor; CDF; Human Interleukin for DA cells; HILDA
Reconstitution
It is not recommended to reconstitute to a concentration less than 100 µg/mL in sterile ddH₂O. For long-term storage of the reconstituted solution, it is recommended to add a carrier protein (e.g., 0.1% BSA, 5% HSA, 10% FBS, or 5% Trehalose).
References
[1] Metcalf D, et al. Effects of injected leukemia inhibitory factor on hematopoietic and other tissues in mice. Blood. 1990 Jul 1;76(1):50-6.
[2] Banner LR, et al. Leukemia inhibitory factor is an anti-inflammatory and analgesic cytokine. J Neurosci. 1998 Jul 15;18(14):5456-62.
[3] Gearing DP, et al. Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130. EMBO J. 1991 Oct;10(10):2839-48.
Order information
|
Cat./REF. |
Size |
Price($£© |
Price(€) |
Price(£¤/CNY£© |
Price(£¤/JYP£© |
|
CYT-P09056 |
10ug |
$185.00 |
€ 222.00 |
£¤1,850.00 |
£¤36,815.00 |
|
CYT-P09056 |
50ug |
$325.00 |
€ 390.00 |
£¤3,250.00 |
£¤64,675.00 |
|
CYT-P09056 |
100ug |
$565.00 |
€ 678.00 |
£¤5,650.00 |
£¤112,435.00 |


