Recombinant Human IL-11, CYT-P20809

Product Description

IL-11 Protein, Human (CHO) is a protective factor derived from CHO cells. It plays a protective role, can accelerate platelet recovery, and significantly reduce the extent of inflammatory responses.

Background

Recombinant human Interleukin-11 (IL-11) plays a very important role in inflammation. As a significant cytokine, IL-11 promotes chronic gastric inflammation and is associated with STAT3 and STAT1-mediated tumorigenesis. Furthermore, IL-11 is an indispensable factor in IL-13-induced Th2-mediated inflammatory diseases and tissue remodeling. IL-11 possesses multiple biological functions. It has a protective effect against neutron radiation injury, can promote faster recovery of small intestine damage, and also responds to inflammation in infected animal models. Studies indicate that IL-11 can protect animal models of sepsis from liver injury. Although the role of IL-11 in neonatal thrombopoiesis is unclear, IL-11 has been reported to be involved in the endogenous cytokine response in preterm infants with sepsis or necrotizing enterocolitis (NEC). IL-11 is also involved in the NF-¦ÊB signaling pathway, and inhibiting IL-6 can reduce colitis-associated tumorigenesis [1]. Recombinant human Interleukin-11 directly promotes megakaryocytopoiesis in vitro [2].

Biological Activity£ºThe ED50 is <5 ng/mL, as measured in a proliferation assay using TF-1 cells.

Species£ºHuman

Expression System£ºCHO

Tag£ºTag Free

Protein Accession No.£ºP20809-1 (P22-L199)

Gene ID£º 3589 [NCBI]
Protein Name: IL-11 (P22-L199)
Accession #: P20809-1
Protein Length: Full Length of Isoform-1 Mature Protein
Synonyms: rHuIL-11; Adipogenesis inhibitory factor; AGIF
Amino Acid Sequence:PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGA

LGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Molecular Weight: Approximately 23 kDa
Purity: ¡Ý 95%, as determined by reducing SDS-PAGE.
Appearance: Sterile powder
Composition: Lyophilized after extensive dialysis against PBS.
Endotoxin Level: <0.2 EU/¦Ìg, determined by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 ¦Ìg/mL in ddH₂O. For long-term storage, it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS, or 5% Trehalose).

Storage & Stability

Stored at -20¡æ for 2 years from the date of receipt. After reconstitution, it is stable at 4¡æ for 1 week or at -20¡æ for longer periods (with carrier protein). It is recommended to freeze aliquots at -20¡æ or -80¡æ for extended storage.

Shipping Conditions

Room temperature in the continental US; may vary elsewhere.

Order Information