Reagent
Guide
Guide_img
Reagent
Guide_img
Cytokine
Guide_img
Human Cytokine
Guide_img2
Human MIP-3 alpha/CCL20 Protein, CYT-P78556
Click£º1393     Release date£º2021-3-25    Author£ºAdministrator    Source£ºOriginal

Human MIP-3 alpha/CCL20 Protein, CYT-P78556

Product Introduction

CCL20, also known as macrophage inflammatory protein-3 alpha (MIP-3¦Á) and liver activation regulated chemokine (LARC), is a small cytokine belonging to the CC chemokine family, located on chromosome 2 in the human genome. It is expressed at low levels in the thymus, testis, prostate, and intestine. CCL20 binds to and acts on the chemokine receptor CCR6, attracting lymphocytes and mild neutrophils. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. CCL20 has antimicrobial activity and is associated with inflammatory bowel disease, rheumatoid arthritis, psoriasis, other autoimmune diseases, and tumor diseases. It can induce Treg cell invasion into tumor tissue, recruit dendritic cells to promote immunosuppression, and induce endothelial cell proliferation and neointima formation. This recombinant human CCL20 (Ala27-Met96) is expressed by E. coli with a tag-free format.

Product Features

1. High Purity: ¡Ý95% as determined by reducing SDS-PAGE.

2. High Biological Activity: Determined by chemotaxis bioassay using human T-lymphocytes, THP-1 cells, or BaF3 cells transfected with human CCR6.

3. E. coli Expression: Produced in E. coli with tag-free format for native protein structure.

4. Low Endotoxin: <1 EU/µg, determined by LAL method.

5. Antimicrobial Properties: Demonstrates anti-E. coli activity and dose-dependent inhibition of B. abortus RB51.

Specifications

Size: Available in 2 µg and 10 µg

Species: Human

Expression System: E. coli

Tag: Tag Free

Protein Accession: P78556-1 (Ala27-Met96)

Gene ID: 6364 (NCBI)

Protein Length: Full Length of Isoform-1 Mature Protein

Amino Acid Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQT

WVKYIVRLLSKKVKNM

Predicted Molecular Weight: 8 kDa

Apparent Molecular Weight: Approximately 9 kDa, based on SDS-PAGE under reducing conditions

Purity: ¡Ý95% as determined by reducing SDS-PAGE

Biological Activity:

1. Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10.0-50.0 ng/mL.

2. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is ¡Ü10.35 ng/mL, corresponding to a specific activity of ¡Ý9.662¡Á10⁴ U/mg.

3. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR6. The ED50 for this effect is <2 ng/mL, corresponding to a specific activity of >5¡Á10⁵ U/mg.

Endotoxin: <1 EU/µg (LAL method)

Form: Lyophilized powder

Formulation: Lyophilized from a 0.22 µm filtered solution of 20 mM PB, 100 mM NaCl, pH 7.4, or PBS, pH 7.4. Please refer to the lot-specific COA for specific buffer information.

Storage and Stability

Storage Conditions: Stored at -20¡ãC for 2 years from date of receipt. After reconstitution, stable at 4¡ãC for 1 week or -20¡ãC for longer (with carrier protein). It is recommended to freeze aliquots at -20¡ãC or -80¡ãC for extended storage.

Shipping Conditions: Room temperature in continental US; may vary elsewhere.

Protocol (For Reference Only)

Important: Centrifuge the vial briefly before opening to bring the contents to the bottom. Reconstitute under aseptic conditions.

1. Reconstitution: It is not recommended to reconstitute to a concentration less than 100 µg/mL in ddH₂O. For long-term storage, it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

2. Aliquoting: Apportion stock solutions into working aliquots and store at ¡Ü -20¡ãC. Avoid repeated freeze-thaw cycles.

3. Chemotaxis Assay: The biological activity can be determined by chemotaxis bioassay using human T-lymphocytes (10.0-50.0 ng/mL), THP-1 cells (ED50 ¡Ü10.35 ng/mL), or BaF3 cells transfected with human CCR6 (ED50 <2 ng/mL).

4. Working Concentration: Optimal working concentrations should be determined empirically for each cell type and experimental system.

Precautions

1. Store at -20¡ãC upon receipt. After reconstitution, add a carrier protein for long-term storage.

2. Do not reconstitute to a concentration less than 100 µg/mL to avoid protein loss.

3. Avoid repeated freeze-thaw cycles; aliquot into single-use volumes.

4. Refer to the lot-specific Certificate of Analysis for specific buffer information.

5. For research use only. Not for use in diagnostic or therapeutic procedures.

FAQ (Simplified)

Q1: What receptor does CCL20 bind to?

A1: CCL20 binds to and acts on the chemokine receptor CCR6, attracting lymphocytes and mild neutrophils.

Q2: What are the known biological activities of CCL20?

A2: CCL20 is involved in chemotaxis of lymphocytes and neutrophils, antimicrobial activity, autoimmune disease pathogenesis, tumor immunity, and regulation of Treg cell migration into tumor tissues.

Q3: How should I store this product?

A3: Store at -20¡ãC for up to 2 years from date of receipt. After reconstitution, add carrier protein and store at -20¡ãC or -80¡ãC. Avoid repeated freeze-thaw cycles.

Q4: What cell types express CCL20?

A4: CCL20 is expressed at low levels in the thymus, testis, prostate, and intestine. It is upregulated in response to pro-inflammatory cytokines such as IL-1¦Á and TNF-¦Á.

Disclaimer

1. For Research Use Only. Not for use in diagnostic or therapeutic procedures.

2. Due to the variable nature of biological research, optimization of working concentrations is recommended for specific cell types and experimental systems.

3. This warranty is limited to the replacement of the product. The manufacturer assumes no liability for incidental or consequential damages, including loss of samples or data.

4. Wear appropriate protective clothing and gloves when handling this product.

Ordering Information

Catalog Number: CYT-P78556

Product Name: MIP-3 alpha/CCL20 Protein, Human

Size: 2 µg / 10 µg

Suggested Retail Price:

2 µg: CNY ¥1500.00 / USD $150.00 / EUR €180.00 / JPY ¥27000.00

10 µg: CNY ¥3600.00 / USD $360.00 / EUR €432.00 / JPY ¥64800.00

Note: The specific price is subject to the transaction price in the offline contract. This document is provided for technical reference only and does not constitute any form of sales advertisement or invitation to offer. For product details and purchase inquiries, please contact local sales representatives.

InCellGene


Copyright @ 2003-2026 InCellGene LLC.
twitter.com
facebook.com
linkedin.com
dribbble.com