Recombinant Human IGFBP7,CYT-Q16270F

Description

This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm.

AlternativeNames

Insulin Like Growth Factor Binding Protein 7,FSTL2; IGFBP-7v; MAC25; PSF; TAF; IGFBP-rP1; MAC25 protein; Prostacyclin-stimulating factor; PGI2-stimulating factor; Tumor-derived adhesion factor.

PROPERTIES

Source: Human Cells

Host: HEK293

Residues: Ser2~Leu282

Tags: H-Fc Tag

Subcellular Location: Secreted

Purity: > 95%

Traits: Freeze-dried powder

Buffer formulation: PBS, pH7.4 .

Applications: Positive Control; Immunogen; SDS-PAGE; WB.

(May be suitable for use in other assays to be determined by the end user.)

Activity Assay:Immobilized Human CD93, His Tag at 2 ¦Ìg/mL (100 ¦Ìl/well) on the plate. Dose response curve for Human IGFBP-7, hFc Tag with the EC50 of 0.80 ¦Ìg/mL determined by ELISA.

Predicted Molecular Mass: 53.2kDa

Accurate Molecular Mass: 57-70kDa as determined by SDS-PAGE reducing conditions.

USAGE

Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

STORAGE AND STABILITY

Storage: Avoid repeated freeze/thaw cycles. Store at 2-8ºC for one month.

Aliquotand store at -80ºC for 12 months.

Stability Test: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37¡ãC for 48h, and no

obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

SEQUENCE

SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGV

CVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKV

KRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Order Information

IMPORTANT NOTE

The Product is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.