Recombinant SOST Protein, Mouse (HEK293, His), CYT-74499
Product Introduction
SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. Recombinant SOST Protein, Mouse (HEK293, His) is a recombinant mouse-derived SOST protein expressed in HEK293 cells with a C-terminal 6×His tag.
Research Background
SOST protein acts as a potent negative regulator of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key components of the Wnt pathway, including LRP4, LRP5, and LRP6. Notably, its interaction with LRP4 (mediated through the extracellular domain) contributes to the inhibition of Wnt signaling, while its interaction with LRP5 (particularly through the first two YWTD-EGF repeat domains) contributes to the inhibition of Wnt-mediated signaling. These molecular interactions highlight the critical role of SOST in regulating the complex signaling cascades that control skeletal development, providing an important regulatory mechanism for maintaining bone homeostasis.
Product Features
1. Biologically Active: Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells, with an ED50 of 1.080 µg/mL in the presence of 20 ng/mL Recombinant Human Wnt3a (specific activity 925.9259 units/mg).
2. HEK293 Expression: Produced in HEK293 cells with proper glycosylation and post-translational processing.
3. C-6×His Tag: Enables convenient detection and purification using anti-His antibodies or nickel affinity chromatography.
4. Glycosylated: Undergoes glycosylation modification consistent with native SOST.
5. Low Endotoxin: <1 EU/µg as determined by LAL method.
Specifications
Size: 5 µg / 10 µg / 50 µg / 100 µg
Species: Mouse
Expression System: HEK293
Tag: C-6×His
Protein Accession: AAK13455.1 (Q24-Y211)
Gene ID: 74499 (NCBI)
Protein Length: Full Length of Sclerostin Chain
Alternative Names: SOST; Sclerosteosis; Sclerostin; SOST1; DAND6; CDD; VBCH
Amino Acid Sequence: QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKGVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY
Predicted Molecular Weight: 21.9 kDa
Apparent Molecular Weight: Approximately 32 kDa, based on SDS-PAGE under reducing conditions
Glycosylation: Yes
Purity: ≥90% as determined by reducing SDS-PAGE
Form: Lyophilized powder
Formulation: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4, or 20 mM PB, 150 mM NaCl, pH 7.4. Please refer to the lot-specific COA for specific buffer information.
Endotoxin: <1 EU/µg (LAL method)
Biological Activity:
1. Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. ED50 = 1.080 µg/mL in the presence of 20 ng/mL Recombinant Human Wnt3a, corresponding to a specific activity of 925.9259 units/mg.
2. Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by MC3T3-E1 cells. ED50 = 0.5-3.0 µg/mL in the presence of 10 ng/mL mouse Wnt3a.
Storage and Stability
Storage Conditions: Stored at -20°C for 2 years from date of receipt. After reconstitution, stable at 4°C for 1 week or -20°C for longer storage (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Protocol (For Reference Only)
Important: Centrifuge the vial briefly before opening to bring the contents to the bottom. Reconstitute under aseptic conditions.
1. Reconstitution: It is not recommended to reconstitute to a concentration less than 100 µg/mL in ddH₂O. For long-term storage, it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
2. Aliquoting: Apportion stock solutions into working aliquots and store at ≤ -20°C. Avoid repeated freeze-thaw cycles.
3. Activity Assay: Biological activity can be measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by MC3T3-E1 cells. ED50 = 1.080 µg/mL in the presence of 20 ng/mL Recombinant Human Wnt3a.
4. Working Concentration: Optimal working concentrations should be determined empirically for each cell type and experimental system.
Precautions
1. Store at -20°C upon receipt. After reconstitution, add a carrier protein for long-term storage.
2. Do not reconstitute to a concentration less than 100 µg/mL to avoid protein loss.
3. Avoid repeated freeze-thaw cycles; aliquot into single-use volumes.
4. Refer to the lot-specific Certificate of Analysis for specific buffer information.
5. For research use only. Not for use in diagnostic or therapeutic procedures.
FAQ (Simplified)
Q1: What is the biological function of SOST protein?
A1: SOST protein is a potent negative regulator of bone growth that inhibits Wnt signaling and subsequent bone formation by interacting with LRP4, LRP5, and LRP6.
Q2: How should I reconstitute this protein?
A2: Reconstitute in sterile deionized water to a concentration of at least 100 µg/mL. For long-term storage, add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Q3: What is the biological activity of this protein?
A3: The ED50 is 1.080 µg/mL as measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by MC3T3-E1 cells in the presence of 20 ng/mL Recombinant Human Wnt3a, corresponding to a specific activity of 925.9259 units/mg.
Q4: How should I store this product?
A4: Store at -20°C for up to 2 years from date of receipt. After reconstitution, store at 4°C for 1 week or at -20°C for longer storage (with carrier protein). Avoid repeated freeze-thaw cycles.
Disclaimer
1. For Research Use Only. Not for use in diagnostic or therapeutic procedures.
2. Due to the variable nature of biological research, optimization of working concentrations is recommended for specific cell types and experimental systems.
3. This warranty is limited to the replacement of the product. The manufacturer assumes no liability for incidental or consequential damages, including loss of samples or data.
4. Wear appropriate protective clothing and gloves when handling this product.
Ordering Information
Catalog Number: CYT-74499
Product Name: Recombinant SOST Protein, Mouse (HEK293, His)
Size: 5 µg / 10 µg / 50 µg / 100 µg
Suggested Retail Price:
5 µg: CNY ¥850.00 / USD $85.00 / EUR �102.00 / JPY ¥15300.00
10 µg: CNY ¥1550.00 / USD $155.00 / EUR �186.00 / JPY ¥27900.00
50 µg: CNY ¥4550.00 / USD $455.00 / EUR �546.00 / JPY ¥81900.00
100 µg: CNY ¥7550.00 / USD $755.00 / EUR �906.00 / JPY ¥135900.00
Note: The specific price is subject to the transaction price in the offline contract. This document is provided for technical reference only and does not constitute any form of sales advertisement or invitation to offer. For product details and purchase inquiries, please contact local sales representatives.
